Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Clostridium acetobutylicum [TaxId:272562] [359731] (2 PDB entries) |
Domain d6aa8b1: 6aa8 B:1-183 [359739] Other proteins in same PDB: d6aa8a2, d6aa8b2, d6aa8b3, d6aa8c2, d6aa8d2, d6aa8e2, d6aa8f2 automated match to d4kuea1 complexed with nad |
PDB Entry: 6aa8 (more details), 2.1 Å
SCOPe Domain Sequences for d6aa8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aa8b1 c.2.1.0 (B:1-183) automated matches {Clostridium acetobutylicum [TaxId: 272562]} mkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieea tkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntssls itevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpveva eap
Timeline for d6aa8b1: