Lineage for d6bfzd1 (6bfz D:0-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948215Species Escherichia coli [TaxId:562] [359490] (4 PDB entries)
  8. 2948225Domain d6bfzd1: 6bfz D:0-139 [359707]
    Other proteins in same PDB: d6bfza2, d6bfza3, d6bfzb2, d6bfzb3, d6bfzc2, d6bfzc3, d6bfzd2, d6bfzd3, d6bfze2, d6bfze3, d6bfzf2, d6bfzf3
    automated match to d2fyma2
    complexed with 2pg, gol, mes, mg, pep, so4

Details for d6bfzd1

PDB Entry: 6bfz (more details), 2.21 Å

PDB Description: crystal structure of enolase from e. coli with a mixture of apo form, substrate, and product form
PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d6bfzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfzd1 d.54.1.0 (D:0-139) automated matches {Escherichia coli [TaxId: 562]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d6bfzd1:

Click to download the PDB-style file with coordinates for d6bfzd1.
(The format of our PDB-style files is described here.)

Timeline for d6bfzd1: