Lineage for d1hnja2 (1hnj A:175-317)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (1 species)
  7. Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)
  8. Domain d1hnja2: 1hnj A:175-317 [35970]

Details for d1hnja2

PDB Entry: 1hnj (more details), 1.46 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii + malonyl-coa

SCOP Domain Sequences for d1hnja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnja2 c.95.1.1 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

SCOP Domain Coordinates for d1hnja2 are not available.

Timeline for d1hnja2:

Domains from same chain:
(mouse over for more information)
d1hnja1