SCOP 1.59: Domain d1hnja1: 1hnj A:1-174

Lineage for d1hnja1 (1hnj A:1-174)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)

7. Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)

8. Domain d1hnja1: 1hnj A:1-174 [35969]

Details for d1hnja1

PDB Entry: 1hnj, 1.46 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii + malonyl-coa

SCOP Domain Sequences for d1hnja1:

Sequence; same for both SEQRES and ATOM records:

>d1hnja1 c.95.1.1 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

Timeline for d1hnja1:

• d1hnja1 first appeared (with stable ids) in SCOP 1.55
  
• d1hnja1 appears in SCOP 1.57
  
• d1hnja1 appears in SCOP 1.61
  
• d1hnja1 appears in the current release, SCOPe 2.08