Lineage for d5yd2b_ (5yd2 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504710Species Entamoeba histolytica [TaxId:885315] [359630] (1 PDB entry)
  8. 2504712Domain d5yd2b_: 5yd2 B: [359673]
    automated match to d3qbob_
    complexed with cl, plp; mutant

Details for d5yd2b_

PDB Entry: 5yd2 (more details), 2.35 Å

PDB Description: crystal structure of delta 4 mutant of ehpsat (phosphoserine aminotransferase of entamoeba histolytica)
PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d5yd2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yd2b_ c.67.1.0 (B:) automated matches {Entamoeba histolytica [TaxId: 885315]}
hnfgamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdipegyei
lffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdknytyip
eyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysliyagaq
kncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqtlkyik
kigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqlenefse
yalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlh

SCOPe Domain Coordinates for d5yd2b_:

Click to download the PDB-style file with coordinates for d5yd2b_.
(The format of our PDB-style files is described here.)

Timeline for d5yd2b_: