SCOP 1.69: Domain d1b3na2: 1b3n A:252-412

Lineage for d1b3na2 (1b3n A:252-412)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (7 proteins)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)

7. Species Escherichia coli [TaxId:562] [53910] (2 PDB entries)

8. Domain d1b3na2: 1b3n A:252-412 [35967]

Details for d1b3na2

PDB Entry: 1b3n, 2.65 Å

PDB Description: beta-ketoacyl carrier protein synthase as a drug target, implications from the crystal structure of a complex with the inhibitor cerulenin.

SCOP Domain Sequences for d1b3na2:

Sequence; same for both SEQRES and ATOM records:

>d1b3na2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

Timeline for d1b3na2:

• d1b3na2 first appeared (with stable ids) in SCOP 1.55
  
• d1b3na2 appears in SCOP 1.67
  
• d1b3na2 appears in SCOP 1.71
  
• d1b3na2 appears in the current release, SCOPe 2.08