Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (6 proteins) |
Protein Beta-ketoacyl-ACP synthase II [53909] (4 species) |
Species Escherichia coli [TaxId:562] [53910] (2 PDB entries) |
Domain d1b3na2: 1b3n A:252-412 [35967] complexed with cer |
PDB Entry: 1b3n (more details), 2.65 Å
SCOP Domain Sequences for d1b3na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3na2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli} kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp degcdldfvphearqvsgmeytlcnsfgfggtngslifkki
Timeline for d1b3na2: