Lineage for d1b3na2 (1b3n A:252-412)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 28401Protein Beta-ketoacyl-ACP synthase II [53909] (2 species)
  7. 28402Species Escherichia coli [TaxId:562] [53910] (2 PDB entries)
  8. 28406Domain d1b3na2: 1b3n A:252-412 [35967]

Details for d1b3na2

PDB Entry: 1b3n (more details), 2.65 Å

PDB Description: beta-ketoacyl carrier protein synthase as a drug target, implications from the crystal structure of a complex with the inhibitor cerulenin.

SCOP Domain Sequences for d1b3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3na2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

SCOP Domain Coordinates for d1b3na2:

Click to download the PDB-style file with coordinates for d1b3na2.
(The format of our PDB-style files is described here.)

Timeline for d1b3na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3na1