SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1b3na2 (1b3n A:252-412)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2146374Family c.95.1.1: Thiolase-related [53902] (10 protein domains)
  6. 2146549Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 2146550Species Escherichia coli [TaxId:562] [53910] (4 PDB entries)
  8. 2146558Domain d1b3na2: 1b3n A:252-412 [35967]
    complexed with cer

Details for d1b3na2

PDB Entry: 1b3n (more details), 2.65 Å

PDB Description: beta-ketoacyl carrier protein synthase as a drug target, implications from the crystal structure of a complex with the inhibitor cerulenin.
PDB Compounds: (A:) protein (ketoacyl acyl carrier protein synthase 2)

SCOPe Domain Sequences for d1b3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3na2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

SCOPe Domain Coordinates for d1b3na2:

Click to download the PDB-style file with coordinates for d1b3na2.
(The format of our PDB-style files is described here.)

Timeline for d1b3na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3na1