Lineage for d1b3na2 (1b3n A:252-412)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2146374Family c.95.1.1: Thiolase-related [53902] (10 protein domains)
  6. 2146549Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 2146550Species Escherichia coli [TaxId:562] [53910] (4 PDB entries)
  8. 2146558Domain d1b3na2: 1b3n A:252-412 [35967]
    complexed with cer

Details for d1b3na2

PDB Entry: 1b3n (more details), 2.65 Å

PDB Description: beta-ketoacyl carrier protein synthase as a drug target, implications from the crystal structure of a complex with the inhibitor cerulenin.
PDB Compounds: (A:) protein (ketoacyl acyl carrier protein synthase 2)

SCOPe Domain Sequences for d1b3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3na2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

SCOPe Domain Coordinates for d1b3na2:

Click to download the PDB-style file with coordinates for d1b3na2.
(The format of our PDB-style files is described here.)

Timeline for d1b3na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3na1