Lineage for d5yssc_ (5yss C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454907Species Citrobacter freundii [TaxId:546] [359622] (1 PDB entry)
  8. 2454910Domain d5yssc_: 5yss C: [359667]
    automated match to d1vl8a_
    complexed with nad

Details for d5yssc_

PDB Entry: 5yss (more details), 2.28 Å

PDB Description: crystal structure of aminocaproic acid cyclase in complex with nad (+)
PDB Compounds: (C:) 3-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d5yssc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yssc_ c.2.1.0 (C:) automated matches {Citrobacter freundii [TaxId: 546]}
nltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgadl
sdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttrl
alpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnalc
pgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaaq
vrgvawnmdggwvaq

SCOPe Domain Coordinates for d5yssc_:

Click to download the PDB-style file with coordinates for d5yssc_.
(The format of our PDB-style files is described here.)

Timeline for d5yssc_: