![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein automated matches [190393] (13 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [359660] (1 PDB entry) |
![]() | Domain d6bgea_: 6bge A: [359661] automated match to d1g6oa_ complexed with dn7, epe, gol, so4 |
PDB Entry: 6bge (more details), 2.9 Å
SCOPe Domain Sequences for d6bgea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bgea_ c.37.1.11 (A:) automated matches {Helicobacter pylori [TaxId: 210]} lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg fkdlidmivhinhhkqcdefyik
Timeline for d6bgea_: