Lineage for d1b3na1 (1b3n A:2-251)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495248Family c.95.1.1: Thiolase-related [53902] (7 proteins)
  6. 495359Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)
  7. 495360Species Escherichia coli [TaxId:562] [53910] (2 PDB entries)
  8. 495363Domain d1b3na1: 1b3n A:2-251 [35966]

Details for d1b3na1

PDB Entry: 1b3n (more details), 2.65 Å

PDB Description: beta-ketoacyl carrier protein synthase as a drug target, implications from the crystal structure of a complex with the inhibitor cerulenin.

SCOP Domain Sequences for d1b3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3na1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli}
krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
mnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiaygd
advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
eyehakkrga

SCOP Domain Coordinates for d1b3na1:

Click to download the PDB-style file with coordinates for d1b3na1.
(The format of our PDB-style files is described here.)

Timeline for d1b3na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3na2