Lineage for d1kas_2 (1kas 252-412)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495248Family c.95.1.1: Thiolase-related [53902] (7 proteins)
  6. 495359Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)
  7. 495360Species Escherichia coli [TaxId:562] [53910] (2 PDB entries)
  8. 495362Domain d1kas_2: 1kas 252-412 [35965]

Details for d1kas_2

PDB Entry: 1kas (more details), 2.4 Å

PDB Description: beta-ketoacyl-acp synthase ii from escherichia coli

SCOP Domain Sequences for d1kas_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kas_2 c.95.1.1 (252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

SCOP Domain Coordinates for d1kas_2:

Click to download the PDB-style file with coordinates for d1kas_2.
(The format of our PDB-style files is described here.)

Timeline for d1kas_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kas_1