SCOP 1.69: Domain d1kas_2: 1kas 252-412

Lineage for d1kas_2 (1kas 252-412)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (7 proteins)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)

7. Species Escherichia coli [TaxId:562] [53910] (2 PDB entries)

8. Domain d1kas_2: 1kas 252-412 [35965]

Details for d1kas_2

PDB Entry: 1kas, 2.4 Å

PDB Description: beta-ketoacyl-acp synthase ii from escherichia coli

SCOP Domain Sequences for d1kas_2:

Sequence; same for both SEQRES and ATOM records:

>d1kas_2 c.95.1.1 (252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

Timeline for d1kas_2:

• d1kas_2 first appeared (with stable ids) in SCOP 1.55
  
• d1kas_2 appears in SCOP 1.67
  
• d1kas_2 appears in SCOP 1.71
  
• d1kas_2 appears in the current release, SCOPe 2.08, called d1kasa2