Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (7 proteins) |
Protein Beta-ketoacyl-ACP synthase II [53909] (4 species) |
Species Escherichia coli [TaxId:562] [53910] (2 PDB entries) |
Domain d1kas_1: 1kas 2-251 [35964] |
PDB Entry: 1kas (more details), 2.4 Å
SCOP Domain Sequences for d1kas_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kas_1 c.95.1.1 (2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli} krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl mnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiaygd advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle eyehakkrga
Timeline for d1kas_1: