Lineage for d1kas_1 (1kas 2-251)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) - Fold c.95: Thiolase-like [53900] (1 superfamily)
- Superfamily c.95.1: Thiolase-like [53901] (2 families)
- Family c.95.1.1: Thiolase-related [53902] (5 proteins)
Protein Beta-ketoacyl-ACP synthase II [53909] (2 species) 
Species Escherichia coli [TaxId:562] [53910] (2 PDB entries) 
Domain d1kas_1: 1kas 2-251 [35964]
Details for d1kas_1
PDB Entry: 1kas (more details), 2.4 Å
PDB Description: beta-ketoacyl-acp synthase ii from escherichia coli
SCOP Domain Sequences for d1kas_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kas_1 c.95.1.1 (2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli}
krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
mnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiaygd
advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
eyehakkrga
SCOP Domain Coordinates for d1kas_1:
Click to download the PDB-style file with coordinates for d1kas_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kas_1:
- d1kas_1 appears in SCOP 1.57
- d1kas_1 appears in the current release, SCOPe 2.08, called d1kasa1
View in 3D
