SCOPe 2.08: Domain d1g5xd2: 1g5x D:254-404

Lineage for d1g5xd2 (1g5x D:254-404)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)

7. Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
   Uniprot P14926

8. Domain d1g5xd2: 1g5x D:254-404 [35963]
   Other proteins in same PDB: d1g5xa1, d1g5xb1, d1g5xc1, d1g5xd1

Details for d1g5xd2

PDB Entry: 1g5x, 2.45 Å

PDB Description: The Structure of Beta-Ketoacyl-[Acyl Carrier Protein] Synthase I

PDB Compounds: (D:) beta-ketoacyl acyl carrier protein synthase I

SCOPe Domain Sequences for d1g5xd2:

Sequence; same for both SEQRES and ATOM records:

>d1g5xd2 c.95.1.1 (D:254-404) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

Timeline for d1g5xd2:

• d1g5xd2 first appeared (with stable ids) in SCOP 1.55
  
• d1g5xd2 appears in SCOPe 2.07