SCOPe 2.07: Domain d6epka2: 6epk A:296-392

Lineage for d6epka2 (6epk A:296-392)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [255299] (4 PDB entries)

8. Domain d6epka2: 6epk A:296-392 [359596]
   Other proteins in same PDB: d6epka1, d6epka3, d6epkd1, d6epkd3
   automated match to d2hg0a2
   complexed with bma, fuc, gol, man, nag, so4

Details for d6epka2

PDB Entry: 6epk, 2.7 Å

PDB Description: crystal structure of the precursor membrane protein-envelope protein heterodimer from the yellow fever virus

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d6epka2:

Sequence; same for both SEQRES and ATOM records:

>d6epka2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus [TaxId: 11089]}
sykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaainkgilvtvnpi
astnddevlievnppfgdsyiivgtgdsrltyqwhke

Timeline for d6epka2:

• d6epka2 is new in SCOPe 2.07-stable
  
• d6epka2 appears in the current release, SCOPe 2.08