Lineage for d6epka2 (6epk A:296-392)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376412Species Yellow fever virus [TaxId:11089] [255299] (4 PDB entries)
  8. 2376418Domain d6epka2: 6epk A:296-392 [359596]
    Other proteins in same PDB: d6epka1, d6epka3, d6epkd1, d6epkd3
    automated match to d2hg0a2
    complexed with bma, fuc, gol, man, nag, so4

Details for d6epka2

PDB Entry: 6epk (more details), 2.7 Å

PDB Description: crystal structure of the precursor membrane protein-envelope protein heterodimer from the yellow fever virus
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d6epka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6epka2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus [TaxId: 11089]}
sykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaainkgilvtvnpi
astnddevlievnppfgdsyiivgtgdsrltyqwhke

SCOPe Domain Coordinates for d6epka2:

Click to download the PDB-style file with coordinates for d6epka2.
(The format of our PDB-style files is described here.)

Timeline for d6epka2: