![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Yellow fever virus [TaxId:11089] [255299] (4 PDB entries) |
![]() | Domain d6epka2: 6epk A:296-392 [359596] Other proteins in same PDB: d6epka1, d6epka3, d6epkd1, d6epkd3 automated match to d2hg0a2 complexed with gol, so4 |
PDB Entry: 6epk (more details), 2.7 Å
SCOPe Domain Sequences for d6epka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6epka2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus [TaxId: 11089]} sykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaainkgilvtvnpi astnddevlievnppfgdsyiivgtgdsrltyqwhke
Timeline for d6epka2: