Lineage for d6er7b_ (6er7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856083Species Pyrococcus horikoshii [TaxId:53953] [359593] (1 PDB entry)
  8. 2856085Domain d6er7b_: 6er7 B: [359594]
    automated match to d3a10a_

Details for d6er7b_

PDB Entry: 6er7 (more details), 2.62 Å

PDB Description: chemotaxis protein chey from pyrococcus horikoshii
PDB Compounds: (B:) 120aa long hypothetical chemotaxis protein (CheY)

SCOPe Domain Sequences for d6er7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6er7b_ c.23.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl

SCOPe Domain Coordinates for d6er7b_:

Click to download the PDB-style file with coordinates for d6er7b_.
(The format of our PDB-style files is described here.)

Timeline for d6er7b_: