Lineage for d1g5xb2 (1g5x B:254-404)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 28367Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 28368Species Escherichia coli [TaxId:562] [53908] (4 PDB entries)
  8. 28396Domain d1g5xb2: 1g5x B:254-404 [35959]

Details for d1g5xb2

PDB Entry: 1g5x (more details), 2.45 Å

PDB Description: The Structure of Beta-Ketoacyl-[Acyl Carrier Protein] Synthase I

SCOP Domain Sequences for d1g5xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5xb2 c.95.1.1 (B:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOP Domain Coordinates for d1g5xb2:

Click to download the PDB-style file with coordinates for d1g5xb2.
(The format of our PDB-style files is described here.)

Timeline for d1g5xb2: