Lineage for d6fpva1 (6fpv A:22-142)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 3059527Domain d6fpva1: 6fpv A:22-142 [359589]
    Other proteins in same PDB: d6fpva2
    automated match to d5j1sc_
    complexed with gol

Details for d6fpva1

PDB Entry: 6fpv (more details), 1.64 Å

PDB Description: a llama-derived jbp1-targeting nanobody
PDB Compounds: (A:) Nanobody

SCOPe Domain Sequences for d6fpva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fpva1 b.1.1.1 (A:22-142) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgsffsindmgwyrqapgkqrelvavissggstnya
dsvegrstissdnakntvylqlsslkpedtavyycnanvrlreyrttsyhywgqgtqvtv
s

SCOPe Domain Coordinates for d6fpva1:

Click to download the PDB-style file with coordinates for d6fpva1.
(The format of our PDB-style files is described here.)

Timeline for d6fpva1:

  • d6fpva1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6fpva2
View in 3D
Domains from other chains:
(mouse over for more information)
d6fpvb_