Lineage for d6gl2a_ (6gl2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833348Species Zobellia galactanivorans [TaxId:63186] [359583] (2 PDB entries)
  8. 2833352Domain d6gl2a_: 6gl2 A: [359584]
    automated match to d3ndza_
    complexed with imd

Details for d6gl2a_

PDB Entry: 6gl2 (more details), 1.96 Å

PDB Description: structure of zgengagh5_4 wild type at 1.2 angstrom resolution
PDB Compounds: (A:) Endoglucanase, family GH5

SCOPe Domain Sequences for d6gl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gl2a_ c.1.8.0 (A:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
gnmreiapkefvldmgagwnlgnamdtynsdetawgnplttkamideiakmgfktlrlpv
twkfhigegpdylieanwldkveaianfalenemyviinihhdetwilptyekadevkde
lskvwtqianrfktygdylifetlneprhkgtpeewkggtqegrdavnqyhqvsvdaira
tggnnakrkimvstyaastasnalndylvpngdknvivsvhsyfpyqfcldgtdstwgte
adktallaeldkirdkfivednravvmgewgstfsdnpedrlahaefyaracaergicpi
wwdngnvdefgifnrntlewnypeiaeaivk

SCOPe Domain Coordinates for d6gl2a_:

Click to download the PDB-style file with coordinates for d6gl2a_.
(The format of our PDB-style files is described here.)

Timeline for d6gl2a_: