SCOPe 2.07: Domain d6fk5a1: 6fk5 A:1-256

Lineage for d6fk5a1 (6fk5 A:1-256)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (14 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [359578] (1 PDB entry)

8. Domain d6fk5a1: 6fk5 A:1-256 [359579]
   Other proteins in same PDB: d6fk5a2
   automated match to d2jc4a_
   complexed with mg, mpd

Details for d6fk5a1

PDB Entry: 6fk5, 2.02 Å

PDB Description: structure of 3' phosphatase nexo (d146n) from neisseria bound to dna substrate in presence of magnesium ion

PDB Compounds: (A:) NExo D146N

SCOPe Domain Sequences for d6fk5a1:

Sequence; same for both SEQRES and ATOM records:

>d6fk5a1 d.151.1.0 (A:1-256) automated matches {Neisseria meningitidis [TaxId: 122586]}
mkittwnvnslnvrlpqvqnlladnppdilvlqelkldqdkfpaaalqmmgwhcvwsgqk
tyngvaivsrsvpqdvhfglpalpddpqrrviaatvsgvrvinvycvngealdspkfkyk
eqwfaaltefvrdemtrhgklvllgnfniapadadcydpekwhekihcssverqwfqnll
dlgltdslrqvhpegafytwfdyrgamfqrklglridhilvspamaaalkdvrvdletra
lerpsdhapvtaefdw

Timeline for d6fk5a1:

• d6fk5a1 is new in SCOPe 2.07-stable
  
• d6fk5a1 appears in the current release, SCOPe 2.08