![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
![]() | Protein automated matches [190734] (14 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122586] [359578] (1 PDB entry) |
![]() | Domain d6fk5a1: 6fk5 A:1-256 [359579] Other proteins in same PDB: d6fk5a2 automated match to d2jc4a_ complexed with mg, mpd |
PDB Entry: 6fk5 (more details), 2.02 Å
SCOPe Domain Sequences for d6fk5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fk5a1 d.151.1.0 (A:1-256) automated matches {Neisseria meningitidis [TaxId: 122586]} mkittwnvnslnvrlpqvqnlladnppdilvlqelkldqdkfpaaalqmmgwhcvwsgqk tyngvaivsrsvpqdvhfglpalpddpqrrviaatvsgvrvinvycvngealdspkfkyk eqwfaaltefvrdemtrhgklvllgnfniapadadcydpekwhekihcssverqwfqnll dlgltdslrqvhpegafytwfdyrgamfqrklglridhilvspamaaalkdvrvdletra lerpsdhapvtaefdw
Timeline for d6fk5a1: