Lineage for d6ew1a3 (6ew1 A:670-763)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375706Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2375758Protein automated matches [190375] (1 species)
    not a true protein
  7. 2375759Species Human (Homo sapiens) [TaxId:9606] [187222] (4 PDB entries)
  8. 2375764Domain d6ew1a3: 6ew1 A:670-763 [359565]
    Other proteins in same PDB: d6ew1a4
    automated match to d2dica1
    mutant

Details for d6ew1a3

PDB Entry: 6ew1 (more details), 2.31 Å

PDB Description: crystal structure of the filamin a ig-like domains 3-5 mutant p637q
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d6ew1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ew1a3 b.1.18.10 (A:670-763) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhpdrvkargpglektgvavnkpaeftvdakhggkaplrvqvqdnegcpvealvkdngng
tyscsyvprkpvkhtamvswggvsipnspfrvnv

SCOPe Domain Coordinates for d6ew1a3:

Click to download the PDB-style file with coordinates for d6ew1a3.
(The format of our PDB-style files is described here.)

Timeline for d6ew1a3: