SCOPe 2.07: Domain d6es7b1: 6es7 B:2061-2109

Lineage for d6es7b1 (6es7 B:2061-2109)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
   3 helices, non-globular array; forms interlocked heterodimers with its targets

4. Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family)
   not a true superfamily

5. Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)

6. Protein automated matches [190180] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186918] (6 PDB entries)

8. Domain d6es7b1: 6es7 B:2061-2109 [359555]
   Other proteins in same PDB: d6es7a2, d6es7b2
   automated match to d1kbhb_
   protein/DNA complex

Details for d6es7b1

PDB Entry: 6es7

PDB Description: structure and dynamics conspire in the evolution of affinity between intrinsically disordered proteins

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d6es7b1:

Sequence; same for both SEQRES and ATOM records:

>d6es7b1 a.153.1.1 (B:2061-2109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sispsalqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyv

Timeline for d6es7b1:

• d6es7b1 is new in SCOPe 2.07-stable
  
• d6es7b1 appears in the current release, SCOPe 2.08