Class a: All alpha proteins [46456] (289 folds) |
Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily) 3 helices, non-globular array; forms interlocked heterodimers with its targets |
Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) not a true superfamily |
Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins) |
Protein automated matches [190180] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186918] (6 PDB entries) |
Domain d6es7b1: 6es7 B:2061-2109 [359555] Other proteins in same PDB: d6es7a2, d6es7b2 automated match to d1kbhb_ protein/DNA complex |
PDB Entry: 6es7 (more details)
SCOPe Domain Sequences for d6es7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6es7b1 a.153.1.1 (B:2061-2109) automated matches {Human (Homo sapiens) [TaxId: 9606]} sispsalqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyv
Timeline for d6es7b1: