Lineage for d6es7b1 (6es7 B:2061-2109)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735240Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 2735241Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 2735242Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)
  6. 2735253Protein automated matches [190180] (2 species)
    not a true protein
  7. 2735254Species Human (Homo sapiens) [TaxId:9606] [186918] (6 PDB entries)
  8. 2735266Domain d6es7b1: 6es7 B:2061-2109 [359555]
    Other proteins in same PDB: d6es7a2, d6es7b2
    automated match to d1kbhb_
    protein/DNA complex

Details for d6es7b1

PDB Entry: 6es7 (more details)

PDB Description: structure and dynamics conspire in the evolution of affinity between intrinsically disordered proteins
PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d6es7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6es7b1 a.153.1.1 (B:2061-2109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sispsalqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyv

SCOPe Domain Coordinates for d6es7b1:

Click to download the PDB-style file with coordinates for d6es7b1.
(The format of our PDB-style files is described here.)

Timeline for d6es7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6es7b2