Lineage for d6es6b_ (6es6 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735240Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 2735241Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 2735242Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)
  6. 2735253Protein automated matches [190180] (2 species)
    not a true protein
  7. 2735254Species Human (Homo sapiens) [TaxId:9606] [186918] (6 PDB entries)
  8. 2735267Domain d6es6b_: 6es6 B: [359550]
    automated match to d2c52a_
    protein/DNA complex

Details for d6es6b_

PDB Entry: 6es6 (more details)

PDB Description: structure and dynamics conspire in the evolution of affinity between intrinsically disordered proteins
PDB Compounds: (B:) ncbd

SCOPe Domain Sequences for d6es6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6es6b_ a.153.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsippnalqdllrtlrspsspqqqqqvlnilksnpqlmaafikqraakyq

SCOPe Domain Coordinates for d6es6b_:

Click to download the PDB-style file with coordinates for d6es6b_.
(The format of our PDB-style files is described here.)

Timeline for d6es6b_: