Lineage for d6emma1 (6emm A:4-270)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2426443Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2427753Protein automated matches [190085] (51 species)
    not a true protein
  7. 2427987Species Human (Homo sapiens) [TaxId:9606] [186828] (30 PDB entries)
  8. 3059487Domain d6emma1: 6emm A:4-270 [359549]
    Other proteins in same PDB: d6emma2
    automated match to d5icsa_
    complexed with nad, peg, pg4, sal

Details for d6emma1

PDB Entry: 6emm (more details), 2.47 Å

PDB Description: 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid
PDB Compounds: (A:) 17-beta-hydroxysteroid dehydrogenase 14

SCOPe Domain Sequences for d6emma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6emma1 c.2.1.2 (A:4-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgygckasrstpvdapdips

SCOPe Domain Coordinates for d6emma1:

Click to download the PDB-style file with coordinates for d6emma1.
(The format of our PDB-style files is described here.)

Timeline for d6emma1:

  • d6emma1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6emma2