Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Retinal dehydrogenase/reductase 3 [141907] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141908] (15 PDB entries) Uniprot Q9BPX1 4-253 |
Domain d6emma1: 6emm A:4-270 [359549] Other proteins in same PDB: d6emma2 automated match to d5icsa_ complexed with nad, peg, pg4, sal |
PDB Entry: 6emm (more details), 2.47 Å
SCOPe Domain Sequences for d6emma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6emma1 c.2.1.2 (A:4-270) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel lvtggaelgygckasrstpvdapdips
Timeline for d6emma1: