Lineage for d1fj8d1 (1fj8 D:2-253)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881083Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1881104Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 1881105Species Escherichia coli [TaxId:562] [53908] (17 PDB entries)
    Uniprot P14926
  8. 1881216Domain d1fj8d1: 1fj8 D:2-253 [35954]
    complexed with cer

Details for d1fj8d1

PDB Entry: 1fj8 (more details), 2.27 Å

PDB Description: the structure of beta-ketoacyl-[acyl carrier protein] synthase i in complex with cerulenin, implications for drug design
PDB Compounds: (D:) beta-ketoacyl-[acyl carrier protein] synthase I

SCOPe Domain Sequences for d1fj8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj8d1 c.95.1.1 (D:2-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
elehalargahi

SCOPe Domain Coordinates for d1fj8d1:

Click to download the PDB-style file with coordinates for d1fj8d1.
(The format of our PDB-style files is described here.)

Timeline for d1fj8d1: