Lineage for d6enea_ (6ene A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627627Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2627702Protein automated matches [190289] (7 species)
    not a true protein
  7. 2627710Species Enterobacter cloacae [TaxId:550] [320989] (2 PDB entries)
  8. 2627717Domain d6enea_: 6ene A: [359535]
    automated match to d2zfga_
    complexed with bog, c8e, so4

Details for d6enea_

PDB Entry: 6ene (more details), 2.3 Å

PDB Description: ompf orthologue from enterobacter cloacae (ompe35)
PDB Compounds: (A:) Phosphoporin PhoE

SCOPe Domain Sequences for d6enea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enea_ f.4.3.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
aeiynkdgnkldlygkavglhyfsdndgndgdktyarlgfkgetkindqltgygqweynf
qgnnsegadaqsgnktrlafaglkfgdagsfdygrnyglvydaigitdmlpefggdtgvs
dnffsgrtgglatyrnsgffglvdglnfgvqylgknertdalrsngdgwatslsydfdgf
givgaygaadrtnaqqnlqwgkgdkaeqwatglkydanniylaalygemrnaarldngfa
nktqdfsvvaqyqfdfglrpsiayykskakdvegigdedyinyidigatyyfnknmstyv
dyqinqlkddnklginnddtvavglvyqf

SCOPe Domain Coordinates for d6enea_:

Click to download the PDB-style file with coordinates for d6enea_.
(The format of our PDB-style files is described here.)

Timeline for d6enea_: