Lineage for d6enec_ (6ene C:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. Protein automated matches [190289] (7 species)
    not a true protein
  7. Species Enterobacter cloacae [TaxId:550] [320989] (2 PDB entries)
  8. Domain d6enec_: 6ene C: [359529]
    automated match to d2zfga_
    complexed with bog, c8e, so4

Details for d6enec_

PDB Entry: 6ene (more details), 2.3 Å

PDB Description: ompf orthologue from enterobacter cloacae (ompe35)
PDB Compounds: (C:) Outer membrane protein (Porin)

SCOPe Domain Sequences for d6enec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enec_ f.4.3.1 (C:) automated matches {Enterobacter cloacae [TaxId: 550]}
aeiynkdgnkldlygkavglhyfsdndgndgdktyarlgfkgetkindqltgygqweynf
qgnnsegadaqsgnktrlafaglkfgdagsfdygrnyglvydaigitdmlpefggdtgvs
dnffsgrtgglatyrnsgffglvdglnfgvqylgknertdalrsngdgwatslsydfdgf
givgaygaadrtnaqqnlqwgkgdkaeqwatglkydanniylaalygemrnaarldngfa
nktqdfsvvaqyqfdfglrpsiayykskakdvegigdedyinyidigatyyfnknmstyv
dyqinqlkddnklginnddtvavglvyqf

SCOPe Domain Coordinates for d6enec_ are not available.

Timeline for d6enec_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6enea_, d6eneb_