SCOP 1.55: Domain d1fj8b2: 1fj8 B:254-404

Lineage for d1fj8b2 (1fj8 B:254-404)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
4. Superfamily c.95.1: Thiolase-like [53901] (2 families)
5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)

7. Species Escherichia coli [TaxId:562] [53908] (4 PDB entries)

8. Domain d1fj8b2: 1fj8 B:254-404 [35951]

Details for d1fj8b2

PDB Entry: 1fj8, 2.27 Å

PDB Description: the structure of beta-ketoacyl-[acyl carrier protein] synthase i in complex with cerulenin, implications for drug design

SCOP Domain Sequences for d1fj8b2:

Sequence; same for both SEQRES and ATOM records:

>d1fj8b2 c.95.1.1 (B:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOP Domain Coordinates for d1fj8b2 are not available.

Timeline for d1fj8b2:

• d1fj8b2 appears in SCOP 1.57
  
• d1fj8b2 appears in the current release, SCOPe 2.08