SCOPe 2.08: Domain d1fj8b2: 1fj8 B:254-404

Lineage for d1fj8b2 (1fj8 B:254-404)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)

7. Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
   Uniprot P14926

8. Domain d1fj8b2: 1fj8 B:254-404 [35951]
   Other proteins in same PDB: d1fj8a1, d1fj8b1, d1fj8c1, d1fj8d1
   complexed with cer

Details for d1fj8b2

PDB Entry: 1fj8, 2.27 Å

PDB Description: the structure of beta-ketoacyl-[acyl carrier protein] synthase i in complex with cerulenin, implications for drug design

PDB Compounds: (B:) beta-ketoacyl-[acyl carrier protein] synthase I

SCOPe Domain Sequences for d1fj8b2:

Sequence; same for both SEQRES and ATOM records:

>d1fj8b2 c.95.1.1 (B:254-404) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

Timeline for d1fj8b2:

• d1fj8b2 first appeared (with stable ids) in SCOP 1.55
  
• d1fj8b2 appears in SCOPe 2.07