Lineage for d6cicb_ (6cic B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. Protein automated matches [190421] (6 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187302] (87 PDB entries)
  8. Domain d6cicb_: 6cic B: [359491]
    automated match to d4ucha_
    complexed with 7r2, gol, h4b, hem, zn; mutant

Details for d6cicb_

PDB Entry: 6cic (more details), 1.7500000000000002 Å

PDB Description: structure of the human nitric oxide synthase r354a/g357d mutant heme domain in complex with n-(1-(2-(ethyl(methyl)amino)ethyl)-1,2,3,4- tetrahydroquino-lin-6-yl)thiophene-2-carboximidamide
PDB Compounds: (B:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d6cicb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cicb_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfpla
kefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqipp
elvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk

SCOPe Domain Coordinates for d6cicb_ are not available.

Timeline for d6cicb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6cica_