| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
| Domain d5yz3c2: 5yz3 C:246-440 [359452] Other proteins in same PDB: d5yz3a1, d5yz3b1, d5yz3c1, d5yz3d1, d5yz3e_, d5yz3f1, d5yz3f2, d5yz3f3 automated match to d4i50a2 complexed with 94u, acp, ca, cl, gdp, gol, gtp, mes, mg, na |
PDB Entry: 5yz3 (more details), 2.55 Å
SCOPe Domain Sequences for d5yz3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yz3c2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv
Timeline for d5yz3c2: