Lineage for d6fu7c_ (6fu7 C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Psychrobacter arcticus [TaxId:259536] [338566] (12 PDB entries)
  8. Domain d6fu7c_: 6fu7 C: [359446]
    automated match to d5m8hf_
    complexed with cl, mg, prt, trs

Details for d6fu7c_

PDB Entry: 6fu7 (more details), 2.3099999999999996 Å

PDB Description: atp phosphoribosyltransferase (hiszg atpprt) from psychrobacter arcticus in complex with pratp
PDB Compounds: (C:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d6fu7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fu7c_ c.94.1.0 (C:) automated matches {Psychrobacter arcticus [TaxId: 259536]}
lgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvptyv
ehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvnv
arayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvssr
livnqvsykrkfallepildsfknsi

SCOPe Domain Coordinates for d6fu7c_ are not available.

Timeline for d6fu7c_:

Domains from other chains:
(mouse over for more information)
d6fu7d_