Lineage for d5zfxa_ (5zfx A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2434697Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2435078Protein automated matches [196175] (9 species)
    not a true protein
  7. 2435092Species Opisthorchis viverrini [TaxId:6198] [359399] (4 PDB entries)
  8. 2435095Domain d5zfxa_: 5zfx A: [359440]
    automated match to d1mo0b_
    complexed with mg

Details for d5zfxa_

PDB Entry: 5zfx (more details), 1.75 Å

PDB Description: crystal structure of triosephosphate isomerase from opisthorchis viverrini
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d5zfxa_:

Sequence, based on SEQRES records: (download)

>d5zfxa_ c.1.1.1 (A:) automated matches {Opisthorchis viverrini [TaxId: 6198]}
rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektnhaisagvnv
iacigekleereagkteevcfrqmeairknlssadmwnhiviayepvwaigtgktateqq
aqevhlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdf
ieicnana

Sequence, based on observed residues (ATOM records): (download)

>d5zfxa_ c.1.1.1 (A:) automated matches {Opisthorchis viverrini [TaxId: 6198]}
rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektnhaisagvnv
iacigekleereagkteevcfrqmeairknlssadmwnhiviayepvwaktateqqaqev
hlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfieic
nana

SCOPe Domain Coordinates for d5zfxa_:

Click to download the PDB-style file with coordinates for d5zfxa_.
(The format of our PDB-style files is described here.)

Timeline for d5zfxa_: