Lineage for d5zgad_ (5zga D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826415Protein automated matches [196175] (9 species)
    not a true protein
  7. 2826427Species Opisthorchis viverrini [TaxId:6198] [359399] (4 PDB entries)
  8. 2826441Domain d5zgad_: 5zga D: [359435]
    automated match to d1mo0b_
    mutant

Details for d5zgad_

PDB Entry: 5zga (more details), 1.79 Å

PDB Description: crystal structure of triosephosphate isomerase sad deletion and n115a mutant from opisthorchis viverrini
PDB Compounds: (D:) triosephosphate isomerase

SCOPe Domain Sequences for d5zgad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zgad_ c.1.1.1 (D:) automated matches {Opisthorchis viverrini [TaxId: 6198]}
rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektahaisagvnv
iacigekleereagkteevcfrqmeairknlsmwnhiviayepvwaigtgktateqqaqe
vhlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfiei
cnana

SCOPe Domain Coordinates for d5zgad_:

Click to download the PDB-style file with coordinates for d5zgad_.
(The format of our PDB-style files is described here.)

Timeline for d5zgad_: