Lineage for d5zi4a2 (5zi4 A:145-339)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. Protein automated matches [226850] (47 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [359404] (3 PDB entries)
  8. Domain d5zi4a2: 5zi4 A:145-339 [359408]
    Other proteins in same PDB: d5zi4a1, d5zi4b1
    automated match to d1ib6a2
    complexed with nad, oaa

Details for d5zi4a2

PDB Entry: 5zi4 (more details), 2.1 Å

PDB Description: mdh3 wild type, nad-oaa-form
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5zi4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zi4a2 d.162.1.0 (A:145-339) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtnldlvraetflvdylmlknpkigqeqdkttmhrkvtvigghsgetiipiitdkslvfq
ldkqyehfihrvqfggdeivkakqgagsatlsmafagakfaeevlrsfhnekpeteslsa
fvylpglkngkkaqqlvgdnsieyfslpivlrngsvvsidtsvleklspreeqlvntavk
elrkniekgksfild

SCOPe Domain Coordinates for d5zi4a2 are not available.

Timeline for d5zi4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zi4a1
View in 3D
Domains from other chains:
(mouse over for more information)
d5zi4b1, d5zi4b2