SCOPe 2.08: Domain d6bb3c1: 6bb3 C:1-159

Lineage for d6bb3c1 (6bb3 C:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries)

8. Domain d6bb3c1: 6bb3 C:1-159 [359345]
   Other proteins in same PDB: d6bb3a2, d6bb3b2, d6bb3c2, d6bb3d2
   automated match to d1i10d1
   complexed with d4a, nad, so4

Details for d6bb3c1

PDB Entry: 6bb3, 2.4 Å

PDB Description: lactate dehydrogenase in complex with inhibitor 3-((2-chlorophenyl) thio)-6-(6-((4-fluorophenyl)amino)pyridin-2-yl)-4-hydroxy-6- (thiophen-3-yl)-5,6-dihydro-2h-pyran-2-one

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6bb3c1:

Sequence, based on SEQRES records:

>d6bb3c1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d6bb3c1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagsrlnlvqrnvnifkfiipnvvkys
pnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d6bb3c1:

• d6bb3c1 first appeared in SCOPe 2.07