SCOPe 2.07: Domain d6e7dk1: 6e7d K:79-194

Lineage for d6e7dk1 (6e7d K:79-194)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries)

8. Domain d6e7dk1: 6e7d K:79-194 [359337]
   Other proteins in same PDB: d6e7da2, d6e7dc2, d6e7dd2, d6e7dg2, d6e7di2, d6e7dk2, d6e7dm2, d6e7do2
   automated match to d3rs1a_
   complexed with nag, so4

Details for d6e7dk1

PDB Entry: 6e7d, 2.9 Å

PDB Description: structure of the inhibitory nkr-p1b receptor bound to the host-encoded ligand, clr-b

PDB Compounds: (K:) C-type lectin domain family 2 member D

SCOPe Domain Sequences for d6e7dk1:

Sequence; same for both SEQRES and ATOM records:

>d6e7dk1 d.169.1.0 (K:79-194) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
acpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfdswi
glhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicskln

Timeline for d6e7dk1:

• d6e7dk1 is new in SCOPe 2.07-stable
  
• d6e7dk1 appears in the current release, SCOPe 2.08