SCOPe 2.07: Domain d6h7jd1: 6h7j D:6-120

Lineage for d6h7jd1 (6h7j D:6-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d6h7jd1: 6h7j D:6-120 [359334]
   Other proteins in same PDB: d6h7jc2, d6h7jd2
   automated match to d5da4a_
   complexed with 2cv, 5fw, na

Details for d6h7jd1

PDB Entry: 6h7j, 2.8 Å

PDB Description: activated turkey beta1 adrenoceptor with bound agonist isoprenaline and nanobody nb80

PDB Compounds: (D:) Camelid antibody fragment Nb80

SCOPe Domain Sequences for d6h7jd1:

Sequence; same for both SEQRES and ATOM records:

>d6h7jd1 b.1.1.1 (D:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifsintmgwyrqapgkqrelvaaihsggstnyansvkg
rftisrdnaantvylqmnslkpedtavyycnvkdygavlyeydywgqgtqvtvss

Timeline for d6h7jd1:

• d6h7jd1 is new in SCOPe 2.07-stable
  
• d6h7jd1 appears in the current release, SCOPe 2.08