Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d6h7jd1: 6h7j D:6-120 [359334] Other proteins in same PDB: d6h7jc2, d6h7jd2, d6h7je_, d6h7jf_ automated match to d5da4a_ complexed with 2cv, 5fw, na |
PDB Entry: 6h7j (more details), 2.8 Å
SCOPe Domain Sequences for d6h7jd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h7jd1 b.1.1.1 (D:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqaggslrlscaasgsifsintmgwyrqapgkqrelvaaihsggstnyansvkg rftisrdnaantvylqmnslkpedtavyycnvkdygavlyeydywgqgtqvtvss
Timeline for d6h7jd1:
View in 3D Domains from other chains: (mouse over for more information) d6h7jc1, d6h7jc2, d6h7je_, d6h7jf_ |