| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
| Protein Biosynthetic thiolase, C-terminal domain [419021] (1 species) |
| Species Zoogloea ramigera [TaxId:350] [419503] (16 PDB entries) Uniprot P07097 |
| Domain d1dlvd2: 1dlv D:269-392 [35931] Other proteins in same PDB: d1dlva1, d1dlvb1, d1dlvc1, d1dlvd1 complexed with coa, so4 |
PDB Entry: 1dlv (more details), 2.29 Å
SCOPe Domain Sequences for d1dlvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlvd2 c.95.1.1 (D:269-392) Biosynthetic thiolase, C-terminal domain {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl
Timeline for d1dlvd2: