Lineage for d6hosb_ (6hos B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. Superfamily b.179.1: PA14-like [254123] (4 families) (S)
  5. Family b.179.1.0: automated matches [254312] (1 protein)
    not a true family
  6. Protein automated matches [254716] (4 species)
    not a true protein
  7. Species Komagataella pastoris [TaxId:4922] [359294] (1 PDB entry)
  8. Domain d6hosb_: 6hos B: [359295]
    automated match to d4lhka_
    complexed with ca, gol, mg, p33, pg4

Details for d6hosb_

PDB Entry: 6hos (more details), 2.15 Å

PDB Description: structure of the kpflo2 adhesin domain in complex with glycerol
PDB Compounds: (B:) ba75_04148t0

SCOPe Domain Sequences for d6hosb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hosb_ b.179.1.0 (B:) automated matches {Komagataella pastoris [TaxId: 4922]}
sayacdidatrydgfnatiyefqpgdgrltrdpvfmstgylnrtqlhsitgvtdpgfsiy
tpgvptttlygipnvnwenlllelkgyfraevsgdyglslrniddsailffgketafqcc
nensisneastdyslftifrqegdettnldsftytqyleagkyypvrtffvnierhavfn
ftmtlpdgteltdfhnyiyqfgaldeeqcqa

SCOPe Domain Coordinates for d6hosb_ are not available.

Timeline for d6hosb_:

Domains from other chains:
(mouse over for more information)
d6hosa_