SCOPe 2.07: Domain d6flai_: 6fla I:

Lineage for d6flai_ (6fla I:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Dengue virus 2 [TaxId:11060] [268950] (4 PDB entries)

8. Domain d6flai_: 6fla I: [359280]
   Other proteins in same PDB: d6flab1, d6flab2, d6flag_, d6flal1, d6flal2
   automated match to d3egpa_
   complexed with cl, gol

Details for d6flai_

PDB Entry: 6fla, 2.9 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 1

PDB Compounds: (I:) Domain III of Dengue virus 2

SCOPe Domain Sequences for d6flai_:

Sequence; same for both SEQRES and ATOM records:

>d6flai_ b.1.18.0 (I:) automated matches {Dengue virus 2 [TaxId: 11060]}
ysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpiv
tekdspvnieaeppfgdsyiiigvepgqlklnwfkkgss

Timeline for d6flai_:

• d6flai_ is new in SCOPe 2.07-stable
  
• d6flai_ appears in the current release, SCOPe 2.08