Lineage for d1dlvc1 (1dlv C:4-268)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily) Superfamily c.95.1: Thiolase-like [53901] (2 families) 
Family c.95.1.1: Thiolase-related [53902] (5 proteins) 
Protein Biosynthetic thiolase [53905] (1 species) Species Zoogloea ramigera [TaxId:350] [53906] (4 PDB entries) 
Domain d1dlvc1: 1dlv C:4-268 [35928]
Details for d1dlvc1
PDB Entry: 1dlv (more details), 2.29 Å
PDB Description: biosynthetic thiolase from zoogloea ramigera in complex with coa
SCOP Domain Sequences for d1dlvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlvc1 c.95.1.1 (C:4-268) Biosynthetic thiolase {Zoogloea ramigera}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg
SCOP Domain Coordinates for d1dlvc1:
Click to download the PDB-style file with coordinates for d1dlvc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dlvc1:
View in 3D
