SCOPe 2.08: Domain d6flcl2: 6flc L:108-212

Lineage for d6flcl2 (6flc L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6flcl2: 6flc L:108-212 [359279]
   Other proteins in same PDB: d6flca1, d6flcb_, d6flcg_, d6flch_, d6flci_, d6flcl1
   automated match to d1h3pl2
   complexed with gol

Details for d6flcl2

PDB Entry: 6flc, 2 Å

PDB Description: 2c8 fab bound to ediii of denv 2

PDB Compounds: (L:) Light chain of 2C8 Fab

SCOPe Domain Sequences for d6flcl2:

Sequence; same for both SEQRES and ATOM records:

>d6flcl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d6flcl2:

• d6flcl2 first appeared in SCOPe 2.07