![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries) |
![]() | Domain d6g62a1: 6g62 A:2-113 [359274] Other proteins in same PDB: d6g62a2 automated match to d2xc2a_ |
PDB Entry: 6g62 (more details), 1.5 Å
SCOPe Domain Sequences for d6g62a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g62a1 c.47.1.0 (A:2-113) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rssfvvlkseaefnsalskardgslpsvfyftaawcgpcrlispvilelsnkypdvttyk vdidegglsnaigklnvsavptlqffkggvkkaeivgvdvvrlksvmeqlyk
Timeline for d6g62a1: