Lineage for d6ew8a_ (6ew8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552340Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 2552341Species Human (Homo sapiens) [TaxId:9606] [102923] (33 PDB entries)
  8. 2552380Domain d6ew8a_: 6ew8 A: [359258]
    automated match to d1r2ba_
    complexed with c0q, cl

Details for d6ew8a_

PDB Entry: 6ew8 (more details), 1.84 Å

PDB Description: crystal structure of the bcl6 btb domain in complex with anilinopyrimidine ligand
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d6ew8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ew8a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
dsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfi
kas

SCOPe Domain Coordinates for d6ew8a_:

Click to download the PDB-style file with coordinates for d6ew8a_.
(The format of our PDB-style files is described here.)

Timeline for d6ew8a_: